PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA06g10300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YA
Protein Properties Length: 299aa    MW: 32179.4 Da    PI: 6.5099
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA06g10300genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA100.91.2e-31168224158
   CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                 +ep+YVNaKQy++Il+RR++Rak+e ekkl +k rkpylheSRh+hAl+R+R+sgGrF
  CA06g10300 168 QEPVYVNAKQYHGILRRRESRAKAELEKKL-IKVRKPYLHESRHQHALKRARASGGRF 224
                 69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005219.1E-35166227IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.439167227IPR001289Nuclear transcription factor Y subunit A
PfamPF020456.3E-27169224IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.6E-23170192IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860172192IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.6E-23201224IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0055046Biological Processmicrogametogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MQSKSKSANC VEARTYNVPN STVFSEPWWN TAGNNPVSLG LMGGSASDPP SAEQAVDGGS  60
QSDDGSNEED DDAPEISETT IPMHSAGSYA QVDQNLQSIA STIPPKGDGS LTQPPQLEPV  120
AHSMACAPNL YVDPYYGGML TPFGQHMVPP HVLDLHHPRM PLPHEMAQEP VYVNAKQYHG  180
ILRRRESRAK AELEKKLIKV RKPYLHESRH QHALKRARAS GGRFAKKSDA DTSKGAGSGS  240
EPLLSSAPDV AEWHKDRSLA EHQHSYSNGS GYGKQNSFQE PNYQAQSAQV GEGGSSGQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-18168232266NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2459772e-72AC245977.3 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone sle-58j6 map 1, complete sequence.
GenBankAC2461062e-72AC246106.3 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-9i12 map 1, complete sequence.
GenBankAC2466232e-72AC246623.5 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone slm-36c24 map 1, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016576728.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X1
RefseqXP_016576731.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X1
RefseqXP_016576736.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X1
RefseqXP_016576743.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X1
TrEMBLM1AQ620.0M1AQ62_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000277850.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31112248
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.31e-54nuclear factor Y, subunit A1